PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr026824.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family bHLH
Protein Properties Length: 208aa    MW: 24008.3 Da    PI: 9.0862
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr026824.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH314.5e-101763654
                 HHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
          HLH  6 nerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                   +E++RR+r++  +++L +llPk+  + ++ ls  e   +A++YIks 
  Pbr026824.1 17 RVVEKNRRNRMKLLYSNLYSLLPKQ--TFKEPLSQTEQIDEAIKYIKSQ 63
                 679*********************7..59999***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474592.62E-11980IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.6961163IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.109.7E-91481IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.2E-61762IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MDRNQANESS STKVERRVVE KNRRNRMKLL YSNLYSLLPK QTFKEPLSQT EQIDEAIKYI  60
KSQESKLQKL KEKKESLMRT RKRSYATACV NVENTRSAKA PLIKIHEIDS TLEVVLISGL  120
ENHQFMFYEI IRLLDAEHAN VVHANFSTLG DSVFHGVRAE MGKSMSKFGA ARITEKLNRF  180
INGSTCDQES QQDYFCDFEF QPVTTWD*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009336213.11e-139PREDICTED: transcription factor bHLH36-like
TrEMBLM5VT392e-95M5VT39_PRUPE; Uncharacterized protein
STRINGPOPTR_0019s13090.12e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9063498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.13e-19bHLH family protein